Package: protein8k 0.0.1
protein8k: Perform Analysis and Create Visualizations of Proteins
Read Protein Data Bank (PDB) files, performs its analysis, and presents the result using different visualization types including 3D. The package also has additional capability for handling Virus Report data from the National Center for Biotechnology Information (NCBI) database.
Authors:
protein8k_0.0.1.tar.gz
protein8k_0.0.1.zip(r-4.5)protein8k_0.0.1.zip(r-4.4)protein8k_0.0.1.zip(r-4.3)
protein8k_0.0.1.tgz(r-4.4-any)protein8k_0.0.1.tgz(r-4.3-any)
protein8k_0.0.1.tar.gz(r-4.5-noble)protein8k_0.0.1.tar.gz(r-4.4-noble)
protein8k_0.0.1.tgz(r-4.4-emscripten)protein8k_0.0.1.tgz(r-4.3-emscripten)
protein8k.pdf |protein8k.html✨
protein8k/json (API)
# Install 'protein8k' in R: |
install.packages('protein8k', repos = c('https://simonliles.r-universe.dev', 'https://cloud.r-project.org')) |
Bug tracker:https://github.com/simonliles/protein8k/issues
- p53_tetramerization - P53 Tetramerization Domain Crystal Structure
Last updated 3 years agofrom:4e97277448. Checks:OK: 1 NOTE: 6. Indexed: yes.
Target | Result | Date |
---|---|---|
Doc / Vignettes | OK | Sep 02 2024 |
R-4.5-win | NOTE | Sep 02 2024 |
R-4.5-linux | NOTE | Sep 02 2024 |
R-4.4-win | NOTE | Sep 02 2024 |
R-4.4-mac | NOTE | Sep 02 2024 |
R-4.3-win | NOTE | Aug 03 2024 |
R-4.3-mac | NOTE | Aug 03 2024 |
Exports:fromJSONLgetAtomicRecordgetTitleSectionplot3DplotModelsProtein3Dread.pdbreport_as_dataframesummarysummary.Proteinwrite_viz
Dependencies:base64encbslibcachemclicodetoolscolorspacecommonmarkcpp11crayoncurldigestdplyrfansifarverfastmapfontawesomefsgenericsggplot2gluegridExtragtablehtmltoolshttpuvisobandjquerylibjsonlitelabelinglaterlatticelifecyclelobstrmagickmagrittrMASSMatrixmemoisemgcvmimemunsellnlmepillarpkgconfigprettyunitspromisespryrR6rappdirsRColorBrewerRcpprjsonrlangsassscalesshinysourcetoolsstringistringrtibbletidyselectutf8vctrsviridisLitewithrxtable
Readme and manuals
Help Manual
Help page | Topics |
---|---|
fromJSONL | fromJSONL |
getAtomicRecord | getAtomicRecord |
getTitleSection | getTitleSection |
P53 Tetramerization Domain Crystal Structure | p53_tetramerization |
plot3D | plot3D |
plotModels | plotModels |
Protein Class Definitions | Protein-class |
plot3DInteractive | Protein3D |
read.pdb | read.pdb |
report_as_dataframe | report_as_dataframe |
summary.Protein | summary summary,Protein,ANY-method summary,Protein-method |
summary.Protein | summary.Protein |
write_viz | write_viz |